Stupid Must Knows – Screen

BY IN Tutorials, Unix 2 COMMENTS ,

Prevent losing your work due to broken connections using screen. Especially great when working from an unstable connection. For installation and other information, see: http://www.gnu.org/software/screen/ To use screen: ssh into your remote server as usual. Actual using the command screen. You will see an introduction. Just click enter. Now you are using screen! Easy as

CONTINUE READING …

Removing Gap Columns from MSA

BY IN Code, Python, Tutorials NO COMMENTS YET ,

Consider the following multiple sequence alignment: >HUMAN —————–METTNGT-ETWYESLHAVLKALNATLHSNLLCRPGPGL–G– >MOUSE —————–METSNGT-ETWYMSLHAVLKALNTTLHSHLLCRPGPGP–G– >CHICKEN —————–MEEDNRT-EPWHHSLQAMLDALNQTLHRAILHP-ST——- … Let’s say you want to remove the columns from the alignment where the query (human) protein sequence has a gap. You may want to do this for a number of reasons though I had to do this trick to get my local

CONTINUE READING …